PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04660g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 715aa    MW: 78736 Da    PI: 8.4984
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04660g00009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-095215581954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Niben101Scf04660g00009.1 521 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 558
                               664459******************************88 PP

2BELL94.88e-313984521872
                      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +VdkrY++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhF+cLkdaia q+
  Niben101Scf04660g00009.1 398 KVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYTALAQKAMSRHFKCLKDAIAAQL 452
                               7***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-60316450IPR006563POX domain
PfamPF075262.6E-40321449IPR006563POX domain
PROSITE profilePS5007112.487499562IPR001356Homeobox domain
CDDcd000861.30E-12502563No hitNo description
SMARTSM003898.4E-9502566IPR001356Homeobox domain
SuperFamilySSF466893.94E-17504572IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27505566IPR009057Homeodomain-like
PfamPF059203.6E-18519558IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MVIDFNKFKA AHNPIQVSES CNSLDNSMSQ DYHHQGLFSF SSVVDRPQDE QQQQHIAHQI  60
RQEKLRVDGF NPPPPLLAIE EEQSSGLQVY GTAGMLSEMF NFPPGITTAM ATEFLQNHLT  120
QCYRHPNQRP QQQQPPTTNL GSEWFSNRPG MVVSGSLQVP SESFDNSKVL NGRDSITAHC  180
QRQHNHISSI HAVESASAMN LFNMNPQPRS PSPSSAHPTI TLQGVPNAIG GHFGQLVCGG  240
ASNTGNHFNT PNDIGGVNVI EGQGLSLSLS SSLQHLEAAK VEDQLRMSGG EILLFNQGAS  300
QNHHHHQVHV GFGSSLGLVN VLRNSKYAKA AQVLLEEFCS VGRSQLFKKN KVSRNNNTTT  360
SSNPKSNNPS GSNSNNNNSS KDLSPLSAAD RIEHQRRKVD KRYNHYCEQM QMVVNSFDLV  420
MGFGAAAPYT ALAQKAMSRH FKCLKDAIAA QLKHSCALLG EKDATTSGLT KGETPRLKLL  480
DKSLRQQQRA FHQMGMMDAE AWRPQRGLPE RSVTILRAWL FEHFLHPYPS DADKHLLARQ  540
TGLSRNQVSN WFINARVRLW KPMSQNHNNI AQIPTPNSST NTKTTGTGTE TKTAATVTAA  600
TILTVGSDKR SEINILENDP SIVAMNKLCF SENHSEHHES SSMATHEMAH YSFPAIQDSD  660
GMSHREAVSG VKYLTANILA ISDNGTRMIR FGTSAAGDVS LTLGSTREYS FFRLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-15508568565Homeobox protein Meis2
3k2a_B5e-15508568565Homeobox protein Meis2
4xrs_A4e-15508563156Homeobox protein Meis1
4xrs_B4e-15508563156Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769608.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLQ8LLE00.0Q8LLE0_SOLTU; BEL1-related homeotic protein 22 (Fragment)
STRINGSolyc02g065490.2.10.0(Solanum lycopersicum)
STRINGVIT_04s0023g01020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-117BEL1-like homeodomain 2